path :: protein back-translation and alignment

Input sequences

>gi|40643636|emb|CAD60221.1| ABO glycosyltransferase [Homo sapiens]
KPKCHALRPMILFLIMLVLVLFGYGVLSPRSLMPGSLERGFCMAVREPDHLQRVSLPRMV
YPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFL
KLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRAYKRWQDVSMRRME
MISDFCERRFLSEVDYLVCVDVDMEIRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRP
QSQAYIPKDEGDFYYLGGFFGGSVQEMQRLTRACHQAMMVDQANGIEAVWHDESHLNKYL
LRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPKNHQAVRNP
>gi|40643630|emb|CAD60218.1| ABO glycosyltransferase [Homo sapiens]
KPKCHALRPMILFLIMLVLVLFGYGVLSPRSLMPGSLERGFCMAVREPDHLQRVSLPRMV
YPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFL
KLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRAYKRWQDVSMRRME
MISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRP
QSQAYIPKDEGDFYYLGGVLRGVGARGAAAHQGLPPGHDGRPGQRHRGRVARREPPEQVP
AAPQTHQGALPRVLVGPAAAGLARRPEEAEVHCGAQEPPGGPEPV

Alignment of back-translated graphs

Score: 2842.66
E-value: 4.4672768876829694E-216

Sequence 1
fragment
Sequence 2
fragment
Reading frame
difference
ScoreE-value
[1 .. 775][1 .. 775]02497.953.282198359330008E-189
[775 .. 1033][776 .. 1034]2404.714.5687357413699906E-26
 K  P  K  C  H  A  L  R  P  M  I  L  F  L  I  M  L  V  L  V  L  F  G  Y  G  V  L  S  P  R 
AAACCAAAATGTCATGCATTACGACCAATGATATTATTTTTAATAATGTTAGTATTAGTATTATTTGGATATGGAGTATTATCACCACGA
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
AAACCAAAATGTCATGCATTACGACCAATGATATTATTTTTAATAATGTTAGTATTAGTATTATTTGGATATGGAGTATTATCACCACGA
 K  P  K  C  H  A  L  R  P  M  I  L  F  L  I  M  L  V  L  V  L  F  G  Y  G  V  L  S  P  R 



 S  L  M  P  G  S  L  E  R  G  F  C  M  A  V  R  E  P  D  H  L  Q  R  V  S  L  P  R  M  V 
TCATTAATGCCAGGATCATTAGAACGAGGATTTTGTATGGCAGTACGAGAACCAGATCATTTACAACGAGTATCATTACCACGAATGGTA
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
TCATTAATGCCAGGATCATTAGAACGAGGATTTTGTATGGCAGTACGAGAACCAGATCATTTACAACGAGTATCATTACCACGAATGGTA
 S  L  M  P  G  S  L  E  R  G  F  C  M  A  V  R  E  P  D  H  L  Q  R  V  S  L  P  R  M  V 



 Y  P  Q  P  K  V  L  T  P  C  R  K  D  V  L  V  V  T  P  W  L  A  P  I  V  W  E  G  T  F 
TATCCACAACCAAAAGTATTAACACCATGTCGAAAAGATGTATTAGTAGTAACACCATGGTTAGCACCAATAGTATGGGAAGGAACATTT
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
TATCCACAACCAAAAGTATTAACACCATGTCGAAAAGATGTATTAGTAGTAACACCATGGTTAGCACCAATAGTATGGGAAGGAACATTT
 Y  P  Q  P  K  V  L  T  P  C  R  K  D  V  L  V  V  T  P  W  L  A  P  I  V  W  E  G  T  F 



 N  I  D  I  L  N  E  Q  F  R  L  Q  N  T  T  I  G  L  T  V  F  A  I  K  K  Y  V  A  F  L 
AATATAGATATATTAAATGAACAATTTCGATTACAAAATACAACAATAGGATTAACAGTATTTGCAATAAAAAAATATGTAGCATTTTTA
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
AATATAGATATATTAAATGAACAATTTCGATTACAAAATACAACAATAGGATTAACAGTATTTGCAATAAAAAAATATGTAGCATTTTTA
 N  I  D  I  L  N  E  Q  F  R  L  Q  N  T  T  I  G  L  T  V  F  A  I  K  K  Y  V  A  F  L 



 K  L  F  L  E  T  A  E  K  H  F  M  V  G  H  R  V  H  Y  Y  V  F  T  D  Q  P  A  A  V  P 
AAATTATTTTTAGAAACAGCAGAAAAACATTTTATGGTAGGACATCGAGTACATTATTATGTATTTACAGATCAACCAGCAGCAGTACCA
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
AAATTATTTTTAGAAACAGCAGAAAAACATTTTATGGTAGGACATCGAGTACATTATTATGTATTTACAGATCAACCAGCAGCAGTACCA
 K  L  F  L  E  T  A  E  K  H  F  M  V  G  H  R  V  H  Y  Y  V  F  T  D  Q  P  A  A  V  P 



 R  V  T  L  G  T  G  R  Q  L  S  V  L  E  V  R  A  Y  K  R  W  Q  D  V  S  M  R  R  M  E 
CGAGTAACATTAGGAACAGGACGACAATTATCAGTATTAGAAGTACGAGCATATAAACGATGGCAAGATGTATCAATGCGACGAATGGAA
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
CGAGTAACATTAGGAACAGGACGACAATTATCAGTATTAGAAGTACGAGCATATAAACGATGGCAAGATGTATCAATGCGACGAATGGAA
 R  V  T  L  G  T  G  R  Q  L  S  V  L  E  V  R  A  Y  K  R  W  Q  D  V  S  M  R  R  M  E 



 M  I  S  D  F  C  E  R  R  F  L  S  E  V  D  Y  L  V  C  V  D  V  D  M  E  I  R  D  H  V 
ATGATATCAGATTTTTGTGAACGACGATTTTTATCAGAAGTAGATTATTTAGTATGTGTAGATGTAGATATGGAAATCCGAGATCATGTA
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||.||||||||||||||
ATGATATCAGATTTTTGTGAACGACGATTTTTATCAGAAGTAGATTATTTAGTATGTGTAGATGTAGATATGGAATTCCGAGATCATGTA
 M  I  S  D  F  C  E  R  R  F  L  S  E  V  D  Y  L  V  C  V  D  V  D  M  E  F  R  D  H  V 



 G  V  E  I  L  T  P  L  F  G  T  L  H  P  G  F  Y  G  S  S  R  E  A  F  T  Y  E  R  R  P 
GGAGTAGAAATATTAACACCATTATTTGGAACATTACATCCAGGATTTTATGGATCATCACGAGAAGCATTTACATATGAACGACGACCA
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
GGAGTAGAAATATTAACACCATTATTTGGAACATTACATCCAGGATTTTATGGATCATCACGAGAAGCATTTACATATGAACGACGACCA
 G  V  E  I  L  T  P  L  F  G  T  L  H  P  G  F  Y  G  S  S  R  E  A  F  T  Y  E  R  R  P 



 Q  S  Q  A  Y  I  P  K  D  E  G  D  F  Y  Y  L  G  G   F  F  G  G  S  V  Q  E  M  Q  R  L
CAATCACAAGCATATATACCAAAAGATGAAGGAGATTTTTATTATTTAGGAGGA-TTCTTCGGGGGGTCGGTGCAAGAGATGCAGCGGCT
|||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||.|||:||||||||||
CAATCACAAGCATATATACCAAAAGATGAAGGAGATTTTTATTATTTAGGAGGAGTTCTTCGGGGGGTCGGTGCACGAGGTGCAGCGGCT
 Q  S  Q  A  Y  I  P  K  D  E  G  D  F  Y  Y  L  G  G  V  L  R  G  V  G  A  R  G  A  A  A 



  T  R  A  C  H  Q  A  M  M  V  D  Q  A  N  G  I  E  A  V  W  H  D  E  S  H  L  N  K  Y  L
CACCCGGGCTTGCCACCAGGCCATGATGGTCGACCAGGCCAACGGCATCGAGGCCGTGTGGCACGACGAGAGCCACCTGAACAAGTACCT
||||.|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
CACCAGGGCTTGCCACCAGGCCATGATGGTCGACCAGGCCAACGGCATCGAGGCCGTGTGGCACGACGAGAGCCACCTGAACAAGTACCT
 H  Q  G  L  P  P  G  H  D  G  R  P  G  Q  R  H  R  G  R  V  A  R  R  E  P  P  E  Q  V  P 



  L  R  H  K  P  T  K  V  L  S  P  E  Y  L  W  D  Q  Q  L  L  G  W  P  A  V  L  R  K  L  R
GCTGCGCCACAAACCCACCAAGGTGCTCTCCCCCGAGTACTTGTGGGACCAGCAGCTGCTGGGTTGGCCCGCCGTCCTGCGGAAGCTGCG
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||.||||||||.|
GCTGCGCCACAAACCCACCAAGGTGCTCTCCCCCGAGTACTTGTGGGACCAGCAGCTGCTGGGTTGGCCCGCCGTCCTGAGGAAGCTGAG
 A  A  P  Q  T  H  Q  G  A  L  P  R  V  L  V  G  P  A  A  A  G  L  A  R  R  P  E  E  A  E 



  F  T  A  V  P  K  N  H  Q  A  V  R  N  P 
GTTCACTGCGGTGCCCAAGAACCACCAGGCGGTCCGGAACCCG
|||||||||||||||||||||||||||||||||||||||||||
GTTCACTGCGGTGCCCAAGAACCACCAGGCGGTCCGGAACCCG
 V  H  C  G  A  Q  E  P  P  G  G  P  E  P