path :: protein back-translation and alignment

Input sequences

>sp|Q8AY47|PA2A2_BUNCA Phospholipase A2, beta bungarotoxin A2 chain (Fragment) OS=Bungarus candidus PE=2 SV=1
AVCVSLLGAANIPPHPFNLINFMKMIRYTIPCEKTWGEYVDYGCYCGVGGSGRPIDALDR
CCYVHDNCYGDAEKKHKCNPKMQSYSYKLTKRTTSAMVPQVLVHVLSVIVTARQPSASAI
LNTSSGTRILTPRDIADDI
>sp|P00603|PA22_NAJMO Phospholipase A2 isozyme CM-II OS=Naja mossambica PE=1 SV=1
NLYQFKNMIHCTVPSRPWWHFADYGCYCGRGGKGTAVDDLDRCCQVHDNCYGEAEKLGCW
PYLTLYKYECSQGKLTCSGGNNKCAAAVCNCDLVAANCFAGARYIDANYNINLKERCQ

Alignment of back-translated graphs

Score: 270.85
E-value: 2.220446049250313E-16

Sequence 1
fragment
Sequence 2
fragment
Reading frame
difference
ScoreE-value
[64 .. 225][13 .. 171]0257.871.7763568394002505E-15
[227 .. 412][171 .. 356]273.980.31439250070590163
 F  M  K  M  I  R  Y  T  I  P  C  E  K  T  W  G  E  Y  V  D  Y  G  C  Y  C  G  V  G  G  S 
TTTATGAAAATGATACGCTATACAATACCATGTGAAAAGACGTGGGGGGAGTACGTGGATTATGGATGTTATTGTGGAGTGGGAGGAAGC
||||.|||.|||||||:||:||||:|||||.||   |:|.|||||.||.|.|.||:||||||||||||||||||||||:.||||||||:.
TTTAAGAATATGATACACTGTACAGTACCAAGT---AGGCCGTGGTGGCACTTCGCGGATTATGGATGTTATTGTGGAAGGGGAGGAAAG
 F  K  N  M  I  H  C  T  V  P  S     R  P  W  W  H  F  A  D  Y  G  C  Y  C  G  R  G  G  K 



 G  R  P  I  D  A  L  D  R  C  C  Y  V  H  D  N  C  Y  G  D  A  E  K  K  H  K  C  N  P  K 
GGAAGGCCGATAGATGCCTTAGATAGATGTTGTTACGTACATGATAATTGTTATGGAGATGCAGAAAAAAAACACAAATGTAACCCTAAA
||||.|.||:||||||.||||||||||||||||:|.|||||||||||||||||||||||.|||||||||  .:|.:|...|::|||||..
GGAACGGCGGTAGATGACTTAGATAGATGTTGTCAAGTACATGATAATTGTTATGGAGAAGCAGAAAAA--CTAGGATGTTGGCCCTATC
 G  T  A  V  D  D  L  D  R  C  C  Q  V  H  D  N  C  Y  G  E  A  E  K    L  G  C  W  P  Y  



 M  Q  S  Y  S  Y  K  L  T  K  R  T  T  S  A  M  V  P  Q  V  L  V  H  V  L  S  V  I  V  T 
ATGCAATCTTACAGTTACAAATTAACCAAGAGAACCACATCTGCAATGGTGCCACAAGTACTTGTGCACGTGCTGTCTGTAATTGTGACC
.|:||.|||...|||...||..||:|||||:|||.|.||:|||||:|||||.||..|:||..||||||..||||||||||||||||||||
TTACACTCTATAAGTATGAATGTAGCCAAGGGAAACTCACCTGCAGTGGTGGCAACAATAAATGTGCAGCTGCTGTCTGTAATTGTGACC
L  T  L  Y  K  Y  E  C  S  Q  G  K  L  T  C  S  G  G  N  N  K  C  A  A  A  V  C  N  C  D  



 A  R  Q  P  S  A  S  A  I  L  N  T  S  S  G  T  R  I  L  T  P  R  D  I  A 
GCGCGGCAGCCAAGTGCTTCGGCGATACTAAATACATCGTCGGGAACTAGAATATTAACCCCAAGGGACATTGCC
.||:|||||||||.|||||||.||:|:|||:||||||||.||.||||||.||||||||||:|||||:||:|||||
TCGTGGCAGCCAATTGCTTCGCCGGTGCTAGATACATCGACGCGAACTATAATATTAACCTCAAGGAACGTTGCC
L  V  A  A  N  C  F  A  G  A  R  Y  I  D  A  N  Y  N  I  N  L  K  E  R  C  

    

Protein alignment

PA2A2_BUNCA  18   NLINFMKMIRYTIPCEKTWGEYVDYGCYCGVGGSGRPIDALDRCCYVHDNCYGDAEKKHK  77
                  NL  F  MI  T+P  + W  + DYGCYCG GG G  +D LDRCC VHDNCYG+AEK   
PA22_NAJMO   1    NLYQFKNMIHCTVP-SRPWWHFADYGCYCGRGGKGTAVDDLDRCCQVHDNCYGEAEKL-G  58

PA2A2_BUNCA  78   CNPKMQSYSYKLT--KRTTSAMVPQVLVHVLSVIVTARQPSASA  119
                  C P +  Y Y+ +  K T S    +    V +  + A    A A
PA22_NAJMO   59   CWPYLTLYKYECSQGKLTCSGGNNKCAAAVCNCDLVAANCFAGA  102